(data stored in ACNUC7421 zone)

EMBL: CP001630.PE11

CP001630.PE11        Location/Qualifiers
FT   CDS             13441..13986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Host cell factor C1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33985"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33985.1"
FT                   /translation="MKRLLPSLLILGALTACGGQESSGGTSAQASQPASTQVTTSSTPS
FT                   GPPPAPEPAVEGTCPYLDKSDVAQANGQLVPKVMLSSDETNPACFFYANATEIQLTVRV
FT                   YRGDATTAKALVNEAAPIADSNPATEPAGWEGGSMATDAGAVYAVAKAGDAVVITSNQK
FT                   QTIKAKQIAKLVVQGLAG"
     MKRLLPSLLI LGALTACGGQ ESSGGTSAQA SQPASTQVTT SSTPSGPPPA PEPAVEGTCP        60
     YLDKSDVAQA NGQLVPKVML SSDETNPACF FYANATEIQL TVRVYRGDAT TAKALVNEAA       120
     PIADSNPATE PAGWEGGSMA TDAGAVYAVA KAGDAVVITS NQKQTIKAKQ IAKLVVQGLA       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page