(data stored in ACNUC7421 zone)

EMBL: CP001630.PE110

CP001630.PE110       Location/Qualifiers
FT   CDS             complement(120797..121825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0F05786p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34084"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34084.1"
FT                   /translation="MVLVGAFVGALLLLGLSSFTTLPFSSGPLGGVTPPERIDPFEAAQ
FT                   AGDCLNWDRADLADIGKVECSASHLFEVSGVVDISSEYGPQAPFPDATTWQTINADHCA
FT                   SESLKYLSNKLDPFGKYTVGPLNPGEKRWAAGKRTLRCGLQVAAPSGRLLPAYGSARTQ
FT                   DQSDVHDPGVCLGIQDNSIGDPVSCEEPHTFEIIGVVDLGAGNTRFPTEDEQESLMTER
FT                   CDAIANEYSGGKVIKERGLLVTWDYRAQESWDAGSKLANCKVGALPNGTLLTAWTGSVH
FT                   NPDAPPLAPSNPPQTSAVQQAEATGAPMHSEAPASESSAPSSPAPSSSTPPSSKENEEE
FT                   GG"
     MVLVGAFVGA LLLLGLSSFT TLPFSSGPLG GVTPPERIDP FEAAQAGDCL NWDRADLADI        60
     GKVECSASHL FEVSGVVDIS SEYGPQAPFP DATTWQTINA DHCASESLKY LSNKLDPFGK       120
     YTVGPLNPGE KRWAAGKRTL RCGLQVAAPS GRLLPAYGSA RTQDQSDVHD PGVCLGIQDN       180
     SIGDPVSCEE PHTFEIIGVV DLGAGNTRFP TEDEQESLMT ERCDAIANEY SGGKVIKERG       240
     LLVTWDYRAQ ESWDAGSKLA NCKVGALPNG TLLTAWTGSV HNPDAPPLAP SNPPQTSAVQ       300
     QAEATGAPMH SEAPASESSA PSSPAPSSST PPSSKENEEE GG                          342
//

If you have problems or comments...

PBIL Back to PBIL home page