(data stored in ACNUC7421 zone)

EMBL: CP001630.PE111

CP001630.PE111       Location/Qualifiers
FT   CDS             121985..122737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34085"
FT                   /db_xref="GOA:C6WDU0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34085.1"
FT                   /translation="MTENDGTKNTSNHGTGGNPPPPAAPQGPPPPQQHPAPPEAPGTPP
FT                   SAGPGTPPPGFPPPAPPGPGAVPPKAPPRGQVRNQVAGVTQPRPPSLAEQRAREHALRE
FT                   QEEQRLAYEAEQARKKKLRKRLLIGGGVGVGVVALVAIWYAASTPDEVEAQCTMDGVVV
FT                   DDKYCSESYATSNGGHVSGGFIYIGGSSYRYHYGGSSTPVGQKVSGGSYTMPDNSKVTT
FT                   KSGSTVQRGGFGVVDGGKSSGGTKSGGS"
     MTENDGTKNT SNHGTGGNPP PPAAPQGPPP PQQHPAPPEA PGTPPSAGPG TPPPGFPPPA        60
     PPGPGAVPPK APPRGQVRNQ VAGVTQPRPP SLAEQRAREH ALREQEEQRL AYEAEQARKK       120
     KLRKRLLIGG GVGVGVVALV AIWYAASTPD EVEAQCTMDG VVVDDKYCSE SYATSNGGHV       180
     SGGFIYIGGS SYRYHYGGSS TPVGQKVSGG SYTMPDNSKV TTKSGSTVQR GGFGVVDGGK       240
     SSGGTKSGGS                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page