(data stored in ACNUC7421 zone)

EMBL: CP001630.PE112

CP001630.PE112       Location/Qualifiers
FT   CDS             122738..123901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0115"
FT                   /product="glutathionylspermidine synthase"
FT                   /note="PFAM: glutathionylspermidine synthase; KEGG:
FT                   sus:Acid_7141 glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34086"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU1"
FT                   /inference="protein motif:PFAM:PF03738"
FT                   /protein_id="ACU34086.1"
FT                   /translation="MRRELSVPRPNWQRTVSDQGLVFGAPASRVDGTPRPYWDESVHYA
FT                   FDMSDVLSMEADVELLHNMCMEAVDNVVLTERYRDFGIQEWVWPAIAESWKRRDPHLYG
FT                   RFDLRYDGRGPAKMLEYNADTPTSLLEASVIQWNWKTDVHPDDDQWNSIHEKLVERWAE
FT                   IGGNLPSAELHFTWSGGDASGEDHVTVAYLQETAAEAGMNTVGLAIEEIGWDPLLKRFV
FT                   DLEEATMNTVVKLYPWEWMTDDQFGRHAVESLPATLWVEPLWKMLLSNKALLAVMWEMY
FT                   PGHPNLLPAYLDDPGLLTEYVRKPRLGREGANIQIVAPGYETQTGGVYGKEGFVYQLFD
FT                   PLPDFDGYRPVLGAWVVGDQAAGLGIRESVGLVTDDGAAFVPHRIVE"
     MRRELSVPRP NWQRTVSDQG LVFGAPASRV DGTPRPYWDE SVHYAFDMSD VLSMEADVEL        60
     LHNMCMEAVD NVVLTERYRD FGIQEWVWPA IAESWKRRDP HLYGRFDLRY DGRGPAKMLE       120
     YNADTPTSLL EASVIQWNWK TDVHPDDDQW NSIHEKLVER WAEIGGNLPS AELHFTWSGG       180
     DASGEDHVTV AYLQETAAEA GMNTVGLAIE EIGWDPLLKR FVDLEEATMN TVVKLYPWEW       240
     MTDDQFGRHA VESLPATLWV EPLWKMLLSN KALLAVMWEM YPGHPNLLPA YLDDPGLLTE       300
     YVRKPRLGRE GANIQIVAPG YETQTGGVYG KEGFVYQLFD PLPDFDGYRP VLGAWVVGDQ       360
     AAGLGIRESV GLVTDDGAAF VPHRIVE                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page