(data stored in ACNUC7421 zone)

EMBL: CP001630.PE113

CP001630.PE113       Location/Qualifiers
FT   CDS             123918..124370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0116"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   met:M446_5403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34087"
FT                   /db_xref="GOA:C6WDU2"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU2"
FT                   /inference="protein motif:PFAM:PF03994"
FT                   /protein_id="ACU34087.1"
FT                   /translation="MTTNLALDPGFGSALVQGLGAIVLYAIVGLILMVVGFYAIDWTTP
FT                   GKLSTLVRTGAPNAVIVTAAGLVSMAFIVVIAIYNAGGKLAEGLLTGLVYGLAGIVVQV
FT                   LAVRLLEWVTRLEIGSMIESDRFAPASVVVAAAHVALGLVVAVAIF"
     MTTNLALDPG FGSALVQGLG AIVLYAIVGL ILMVVGFYAI DWTTPGKLST LVRTGAPNAV        60
     IVTAAGLVSM AFIVVIAIYN AGGKLAEGLL TGLVYGLAGI VVQVLAVRLL EWVTRLEIGS       120
     MIESDRFAPA SVVVAAAHVA LGLVVAVAIF                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page