(data stored in ACNUC7421 zone)

EMBL: CP001630.PE115

CP001630.PE115       Location/Qualifiers
FT   CDS             125363..126613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0118"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: bcz:BCZK0013 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34089"
FT                   /db_xref="GOA:C6WDU4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU4"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACU34089.1"
FT                   /translation="MIDLKALRENPEAVRASQRARGEDESLVDALLSADERRRSAVSRA
FT                   DTLRGEQKAFGKQVGKARGEEREALLVKGKELAAEVKAAEADQAAAEAELTELHRSVPN
FT                   LVHPDAPEGGEDDYVVVKHVGEPREFDFEPLDHLDLGTRLGAIDMERGAKVSGSRFYFL
FT                   TGIGAQLELALLNMAVAQATAAGFQLMITPTLVRPEVMAGTGFLGAHSSEIYRLEADDL
FT                   YLVGTSEVPLAGYHADEIIDGPRRYAGWSSCYRREAGSYGKDTRGIIRVHQFNKVEMFS
FT                   YVPPEEAEAEHARLLAWEEEMLAKVEVPYRVIDTAAGDLGTSASRKFDCEAWVPSQQAY
FT                   RELTSTSNCTTFQARRLNVRYRDENGKSQITATLNGTLATTRWIVAILENHQQADGSVV
FT                   VPQALRPFLGKDVLLPA"
     MIDLKALREN PEAVRASQRA RGEDESLVDA LLSADERRRS AVSRADTLRG EQKAFGKQVG        60
     KARGEEREAL LVKGKELAAE VKAAEADQAA AEAELTELHR SVPNLVHPDA PEGGEDDYVV       120
     VKHVGEPREF DFEPLDHLDL GTRLGAIDME RGAKVSGSRF YFLTGIGAQL ELALLNMAVA       180
     QATAAGFQLM ITPTLVRPEV MAGTGFLGAH SSEIYRLEAD DLYLVGTSEV PLAGYHADEI       240
     IDGPRRYAGW SSCYRREAGS YGKDTRGIIR VHQFNKVEMF SYVPPEEAEA EHARLLAWEE       300
     EMLAKVEVPY RVIDTAAGDL GTSASRKFDC EAWVPSQQAY RELTSTSNCT TFQARRLNVR       360
     YRDENGKSQI TATLNGTLAT TRWIVAILEN HQQADGSVVV PQALRPFLGK DVLLPA           416
//

If you have problems or comments...

PBIL Back to PBIL home page