(data stored in ACNUC7421 zone)

EMBL: CP001630.PE116

CP001630.PE116       Location/Qualifiers
FT   CDS             complement(127550..128737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0119"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; HI0933 family
FT                   protein; KEGG: sus:Acid_5855 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34090"
FT                   /db_xref="GOA:C6WDU5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU5"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACU34090.1"
FT                   /translation="MAAVRRIVVIGGGIVGLATARELSRRGDEVVVLEKEGRWAAHQTG
FT                   HNSNVVHAGLYYRPGSLKARMSVAGNASIVAYAREHGVPVEVCGKLVVATSEEEVPRLR
FT                   ALAERASRNGVPARMVSVAEAREHEPEVSCVAALRVESTGIIDFPAVCAAMVRELTAAG
FT                   ADLRTNSPALAIRTRAGRVEVATPSGVVRGDALVNCAGLHSDRVARMAGLEPEARIVPF
FT                   RGEYYELRPERRSLVRGLIYPVPDPTLPFLGVHLTRMLDGSVHAGPNAVLALSREGYRW
FT                   GDVSAGDVAEVLRFPGTWRLARKYAYPTGLAEVLRSLSKRRFAESLARLVPAVGEADLV
FT                   RAEAGVRAQAMRRDGSLVDDFLVQEAPGQVHVLNAPSPAATGSLEIGAHVAGLVR"
     MAAVRRIVVI GGGIVGLATA RELSRRGDEV VVLEKEGRWA AHQTGHNSNV VHAGLYYRPG        60
     SLKARMSVAG NASIVAYARE HGVPVEVCGK LVVATSEEEV PRLRALAERA SRNGVPARMV       120
     SVAEAREHEP EVSCVAALRV ESTGIIDFPA VCAAMVRELT AAGADLRTNS PALAIRTRAG       180
     RVEVATPSGV VRGDALVNCA GLHSDRVARM AGLEPEARIV PFRGEYYELR PERRSLVRGL       240
     IYPVPDPTLP FLGVHLTRML DGSVHAGPNA VLALSREGYR WGDVSAGDVA EVLRFPGTWR       300
     LARKYAYPTG LAEVLRSLSK RRFAESLARL VPAVGEADLV RAEAGVRAQA MRRDGSLVDD       360
     FLVQEAPGQV HVLNAPSPAA TGSLEIGAHV AGLVR                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page