(data stored in ACNUC7421 zone)

EMBL: CP001630.PE117

CP001630.PE117       Location/Qualifiers
FT   CDS             complement(128739..129671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0120"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4411 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34091"
FT                   /db_xref="GOA:C6WDU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU6"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34091.1"
FT                   /translation="MVHVRVPGSATVAVVRTGIVILPEQRWWVAEPKWRVAEEYGFHHA
FT                   WTYDHLGWRTLVDGPWFGAVPTLSAAAMVTSTIRLGTLVASPNFRHPVPFARELMALDD
FT                   LSDGRITVGIGAGAVGYDTTVMGDTELPPAERTARFAEFVDVLDRLLTRERTTFEGAHY
FT                   EVREARSAPGCVQRPRLPFVVAANGPKAMAVAARYGTGWVTTGPPAGSVETAEEWWAGV
FT                   ERYAARFTRALDAIGRRKHTIDWYLNADSSPAYSLSSAGHFRDVAGRAQELGFTDLLAH
FT                   WPREEGVYAGSEAVLERVASEVLPELVSG"
     MVHVRVPGSA TVAVVRTGIV ILPEQRWWVA EPKWRVAEEY GFHHAWTYDH LGWRTLVDGP        60
     WFGAVPTLSA AAMVTSTIRL GTLVASPNFR HPVPFARELM ALDDLSDGRI TVGIGAGAVG       120
     YDTTVMGDTE LPPAERTARF AEFVDVLDRL LTRERTTFEG AHYEVREARS APGCVQRPRL       180
     PFVVAANGPK AMAVAARYGT GWVTTGPPAG SVETAEEWWA GVERYAARFT RALDAIGRRK       240
     HTIDWYLNAD SSPAYSLSSA GHFRDVAGRA QELGFTDLLA HWPREEGVYA GSEAVLERVA       300
     SEVLPELVSG                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page