(data stored in ACNUC7421 zone)

EMBL: CP001630.PE118

CP001630.PE118       Location/Qualifiers
FT   CDS             129678..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0121"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: mno:Mnod_7133 Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34092"
FT                   /db_xref="GOA:C6WDU7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU7"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACU34092.1"
FT                   /translation="MQKPSLVGSDVDGTLLGTDGRLSARTTTAIGRVLESGTPFVLATG
FT                   RPPRWIPEVADAAGLTGHAVCSNGAVLYDVGADRVVGHHGLDPVLLQDVAKVLDAALPG
FT                   CALAVERVGDSARGSDHFRDFLAETSYQHPWIEGGQPILGHSRGEVLGHPAVKLLVRHT
FT                   GMTSAEMAAAAGPLLGDQVALTYSTNSGLLELAAPGVSKATGLAEVAELLGVPREEITV
FT                   FGDMPNDVPMLTWAGHGVAMANAHPEALAAADEVTAANTEDGVAQVLERWF"
     MQKPSLVGSD VDGTLLGTDG RLSARTTTAI GRVLESGTPF VLATGRPPRW IPEVADAAGL        60
     TGHAVCSNGA VLYDVGADRV VGHHGLDPVL LQDVAKVLDA ALPGCALAVE RVGDSARGSD       120
     HFRDFLAETS YQHPWIEGGQ PILGHSRGEV LGHPAVKLLV RHTGMTSAEM AAAAGPLLGD       180
     QVALTYSTNS GLLELAAPGV SKATGLAEVA ELLGVPREEI TVFGDMPNDV PMLTWAGHGV       240
     AMANAHPEAL AAADEVTAAN TEDGVAQVLE RWF                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page