(data stored in ACNUC7421 zone)

EMBL: CP001630.PE119

CP001630.PE119       Location/Qualifiers
FT   CDS             130616..132532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt0624 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34093"
FT                   /db_xref="GOA:C6WDU8"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34093.1"
FT                   /translation="MSTSSEIDSTALGDEPESTTARASRWGRLPELAASWEAPSRAVLS
FT                   FSALLTVIFWNLPAFTPNQPKGDYDYGLLIYLARQTGLSFGTEISTTYGPLYFLAIPNV
FT                   LHRGEVLVGYLLWFAFATAATAAIHQALARTVGRNLAWLAVGVMALSSSFVPLTVVITS
FT                   TFAFVVVLSLFFVREELPRWADRAYPIAMGLLVGAMLLTKFSVGLMCGPVILGAVLARE
FT                   GRVLRGFLEYAISGIAGLVGFWLLAGQPPLEVVDYVVRALSVGSGHAQSMGLEIPGNVW
FT                   EYVIAAPMVVVLVVALVTTDAGKRRWLFYLGTALGTFLLLKQGFVRHDSHSAQFFSVAA
FT                   GFSLVIALLRRSSVLASTAVVALLAQAFSFGGGLSSSIDPSRSLKMFGEGMSVVASGGQ
FT                   RDRIVADARADLLNRMQVPERYVERIGDAKMRTAPFDFAMGWTYGMTVDILPTLLDYGA
FT                   YTELLDEMNEEWVVDDARAPEFIVREDTRITLDNRFPLWDSPRVNLAQACRYELVDSDV
FT                   RWQLLERIENRCGEEKPLGEVTMGAHQSIPVPTSDEGLVVARFHPEQSILAKLKSTAFR
FT                   SGEYWITLDGEPHRLPLSHAEAPILISAPGDDSLVLGGRELDTKNITANIPGRVVFSVV
FT                   TTK"
     MSTSSEIDST ALGDEPESTT ARASRWGRLP ELAASWEAPS RAVLSFSALL TVIFWNLPAF        60
     TPNQPKGDYD YGLLIYLARQ TGLSFGTEIS TTYGPLYFLA IPNVLHRGEV LVGYLLWFAF       120
     ATAATAAIHQ ALARTVGRNL AWLAVGVMAL SSSFVPLTVV ITSTFAFVVV LSLFFVREEL       180
     PRWADRAYPI AMGLLVGAML LTKFSVGLMC GPVILGAVLA REGRVLRGFL EYAISGIAGL       240
     VGFWLLAGQP PLEVVDYVVR ALSVGSGHAQ SMGLEIPGNV WEYVIAAPMV VVLVVALVTT       300
     DAGKRRWLFY LGTALGTFLL LKQGFVRHDS HSAQFFSVAA GFSLVIALLR RSSVLASTAV       360
     VALLAQAFSF GGGLSSSIDP SRSLKMFGEG MSVVASGGQR DRIVADARAD LLNRMQVPER       420
     YVERIGDAKM RTAPFDFAMG WTYGMTVDIL PTLLDYGAYT ELLDEMNEEW VVDDARAPEF       480
     IVREDTRITL DNRFPLWDSP RVNLAQACRY ELVDSDVRWQ LLERIENRCG EEKPLGEVTM       540
     GAHQSIPVPT SDEGLVVARF HPEQSILAKL KSTAFRSGEY WITLDGEPHR LPLSHAEAPI       600
     LISAPGDDSL VLGGRELDTK NITANIPGRV VFSVVTTK                               638
//

If you have problems or comments...

PBIL Back to PBIL home page