(data stored in ACNUC7421 zone)

EMBL: CP001630.PE120

CP001630.PE120       Location/Qualifiers
FT   CDS             132542..133594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0123"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rme:Rmet_6128 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34094"
FT                   /db_xref="GOA:C6WDU9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU9"
FT                   /inference="protein motif:PRIAM:3.1.26.3"
FT                   /protein_id="ACU34094.1"
FT                   /translation="MVGAPASRRKITYIFPIYNEQDNIDLLHQTIDEVTTPLRDRYDLE
FT                   FVYVNDGSRDASLDKLLALRERDERATVISLSRNFGHQLAVTAGLDAAADADAVIIMDA
FT                   DMQDPPRVSLELIERWEQGVDVVYAQRRSRQDGLFKRLTANVFYRTLEKLASIDIPRNT
FT                   GDFRLLDRKVVAELAKYREQHRFLRGLVSYIGFRQEAVQFDRDARHAGETGYPLRKMLK
FT                   FAADGMLGFSTTPLKLISRIGYLLSVVAFTGVLYVLGVKLLDPSSAVPGWAFMTIALFL
FT                   IGGIQLIMLGVLGSYIGRTYVEVQRRPLYAVAVVARSAGRAPDSAEGKGGEGGTPEDGT
FT                   PATEYELQGT"
     MVGAPASRRK ITYIFPIYNE QDNIDLLHQT IDEVTTPLRD RYDLEFVYVN DGSRDASLDK        60
     LLALRERDER ATVISLSRNF GHQLAVTAGL DAAADADAVI IMDADMQDPP RVSLELIERW       120
     EQGVDVVYAQ RRSRQDGLFK RLTANVFYRT LEKLASIDIP RNTGDFRLLD RKVVAELAKY       180
     REQHRFLRGL VSYIGFRQEA VQFDRDARHA GETGYPLRKM LKFAADGMLG FSTTPLKLIS       240
     RIGYLLSVVA FTGVLYVLGV KLLDPSSAVP GWAFMTIALF LIGGIQLIML GVLGSYIGRT       300
     YVEVQRRPLY AVAVVARSAG RAPDSAEGKG GEGGTPEDGT PATEYELQGT                  350
//

If you have problems or comments...

PBIL Back to PBIL home page