(data stored in ACNUC7421 zone)

EMBL: CP001630.PE121

CP001630.PE121       Location/Qualifiers
FT   CDS             133597..134106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0124"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: GtrA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34095"
FT                   /db_xref="GOA:C6WDV0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV0"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACU34095.1"
FT                   /translation="MAVDDQAGRDPAEQALAPEPVISPVPAPVPQPAPSGGLGQLVRFG
FT                   LVGGVNTLIDLVLYMVLTGAGLPFVVANFVSTSAGMGFSFVANKYFTFGGGGGGAAKQG
FT                   ALFFAFTAFGLWVIHPVVILGAEALMAALDQPLTGLAAWLPKLAAICAGLVWNYTAYSR
FT                   VVFRRR"
     MAVDDQAGRD PAEQALAPEP VISPVPAPVP QPAPSGGLGQ LVRFGLVGGV NTLIDLVLYM        60
     VLTGAGLPFV VANFVSTSAG MGFSFVANKY FTFGGGGGGA AKQGALFFAF TAFGLWVIHP       120
     VVILGAEALM AALDQPLTGL AAWLPKLAAI CAGLVWNYTA YSRVVFRRR                   169
//

If you have problems or comments...

PBIL Back to PBIL home page