(data stored in ACNUC7421 zone)

EMBL: CP001630.PE122

CP001630.PE122       Location/Qualifiers
FT   CDS             134133..135434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0125"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: acr:Acry_1134
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34096"
FT                   /db_xref="GOA:C6WDV1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACU34096.1"
FT                   /translation="MQKADTQVTEQDAGGRQEPPAVNGSPSAASPSAASRVPHINQLTG
FT                   IRALAALWVLLFHFRPELIEAFGFLYPLIPLMNVGYLGVDLFFVLSGFILTYTHLDRMI
FT                   VGWGPRKMIAFLWLRLSRIWPVMFTMLIVWGCYLAWLATTTNDGGYHYALQPGRFLAHV
FT                   FLVQAWGTAHHDWNPIDWSLSAEWMAYIAFCFLVVLLAKFRALLSSRALIGLALLAVLP
FT                   IVLVGIGFQDGSDLMWDGDKVVEGMVPLRVLTEFVGGAIVAVLVLRHGLTAKLPWFLRP
FT                   TVVLPLILVVIYAICLYDPAVRVRFAVDWRINGHLMWGATETVVVVPLFLLLVGSLAVS
FT                   GRDVTSRFLSTKVMVWGGKVSFALYLVHWLLLDLMRRLLTSWGYVDDPSSWGYRLLLIA
FT                   ALVLSVVGGWLLHRYVEEPCQRSMRKMLPRSIKV"
     MQKADTQVTE QDAGGRQEPP AVNGSPSAAS PSAASRVPHI NQLTGIRALA ALWVLLFHFR        60
     PELIEAFGFL YPLIPLMNVG YLGVDLFFVL SGFILTYTHL DRMIVGWGPR KMIAFLWLRL       120
     SRIWPVMFTM LIVWGCYLAW LATTTNDGGY HYALQPGRFL AHVFLVQAWG TAHHDWNPID       180
     WSLSAEWMAY IAFCFLVVLL AKFRALLSSR ALIGLALLAV LPIVLVGIGF QDGSDLMWDG       240
     DKVVEGMVPL RVLTEFVGGA IVAVLVLRHG LTAKLPWFLR PTVVLPLILV VIYAICLYDP       300
     AVRVRFAVDW RINGHLMWGA TETVVVVPLF LLLVGSLAVS GRDVTSRFLS TKVMVWGGKV       360
     SFALYLVHWL LLDLMRRLLT SWGYVDDPSS WGYRLLLIAA LVLSVVGGWL LHRYVEEPCQ       420
     RSMRKMLPRS IKV                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page