(data stored in ACNUC7421 zone)

EMBL: CP001630.PE123

CP001630.PE123       Location/Qualifiers
FT   CDS             135536..137167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0126"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: pae:PA1391
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34097"
FT                   /db_xref="GOA:C6WDV2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACU34097.1"
FT                   /translation="MNQLPGIVELLDESGVGLTGGGGLLDERERRILIGAINFHALTRP
FT                   GQTFRITVLRGPRGSMPSLTDEKTRQIEWEDDREVVGSLVVRSTVQTTTGKGATEGLLD
FT                   LAVDLGGEPEIASAYHQLPGVLGKVRRSVRFFAPVQFDVLRQYRTDVTEKRYRQRDVPK
FT                   KAPVRITRGTTATTAGTTPAILFGIHWLELGGAERFALETVQLAKDAGFTPIVVTDRPS
FT                   THPWITRPELDGAIVVPLTHPVAAAEESAFLNGVLSAYDVRGVHLHHSTWLAQRLPWLK
FT                   SIRPDLPVVDSLHILEWRTGGFVDISVRMTNVIDQHHVISPMLRDYLIGKQGVNPEKVK
FT                   LATLANLTTKGIEENTRTEKPAGAPFTVAFVGRFTQQKRPYLFLQLAASLKEAVDSPIK
FT                   FIVHGDGELASEVTGLIARLNLSDVLELRGPDKPVTRTLADADVLVISSDNEGLTLTSF
FT                   EATAAGVPVVSTEVGSQASLIAEDLLLPRHPYPFISTATKRIRTMINSPEQRKIWLDEQ
FT                   AGKAAAFAKLPDARTWVRDTYEGWLK"
     MNQLPGIVEL LDESGVGLTG GGGLLDERER RILIGAINFH ALTRPGQTFR ITVLRGPRGS        60
     MPSLTDEKTR QIEWEDDREV VGSLVVRSTV QTTTGKGATE GLLDLAVDLG GEPEIASAYH       120
     QLPGVLGKVR RSVRFFAPVQ FDVLRQYRTD VTEKRYRQRD VPKKAPVRIT RGTTATTAGT       180
     TPAILFGIHW LELGGAERFA LETVQLAKDA GFTPIVVTDR PSTHPWITRP ELDGAIVVPL       240
     THPVAAAEES AFLNGVLSAY DVRGVHLHHS TWLAQRLPWL KSIRPDLPVV DSLHILEWRT       300
     GGFVDISVRM TNVIDQHHVI SPMLRDYLIG KQGVNPEKVK LATLANLTTK GIEENTRTEK       360
     PAGAPFTVAF VGRFTQQKRP YLFLQLAASL KEAVDSPIKF IVHGDGELAS EVTGLIARLN       420
     LSDVLELRGP DKPVTRTLAD ADVLVISSDN EGLTLTSFEA TAAGVPVVST EVGSQASLIA       480
     EDLLLPRHPY PFISTATKRI RTMINSPEQR KIWLDEQAGK AAAFAKLPDA RTWVRDTYEG       540
     WLK                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page