(data stored in ACNUC7421 zone)

EMBL: CP001630.PE124

CP001630.PE124       Location/Qualifiers
FT   CDS             137164..138063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0127"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bcj:BCAL3234 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34098"
FT                   /db_xref="GOA:C6WDV3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34098.1"
FT                   /translation="MSTVAAVVVTYNRKAKLPKVLDHVLAQTRKADWLVIVDNASTDGT
FT                   DEVLKQYEGVENVEIIRLTENTGGAGGFATGMNRGYELGADFVWIMDDDCYANSDALEE
FT                   LLNGLAKAEAELNMQLPFACSLVKWVDGSICEMNNPVTTWDWGRLISKGQENVLVKHCS
FT                   FVSVMFPRWALTKHGLPLREYFIWFDDQEYTLRVNKSGPGVQVLSSVVVHDLGVNRGVN
FT                   FSDVNASNMWKFEYGARNEASYRLHHENPVAFAKFVGRVHQGLKQGRVPMGLRVKLFKK
FT                   IVEGVKFNPKPEMPRSVL"
     MSTVAAVVVT YNRKAKLPKV LDHVLAQTRK ADWLVIVDNA STDGTDEVLK QYEGVENVEI        60
     IRLTENTGGA GGFATGMNRG YELGADFVWI MDDDCYANSD ALEELLNGLA KAEAELNMQL       120
     PFACSLVKWV DGSICEMNNP VTTWDWGRLI SKGQENVLVK HCSFVSVMFP RWALTKHGLP       180
     LREYFIWFDD QEYTLRVNKS GPGVQVLSSV VVHDLGVNRG VNFSDVNASN MWKFEYGARN       240
     EASYRLHHEN PVAFAKFVGR VHQGLKQGRV PMGLRVKLFK KIVEGVKFNP KPEMPRSVL        299
//

If you have problems or comments...

PBIL Back to PBIL home page