(data stored in ACNUC7421 zone)

EMBL: CP001630.PE125

CP001630.PE125       Location/Qualifiers
FT   CDS             138200..139384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0128"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="KEGG: gox:GOX1488 UDP-galactopyranose mutase;
FT                   TIGRFAM: UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34099"
FT                   /db_xref="GOA:C6WDV4"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV4"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ACU34099.1"
FT                   /translation="MSFAGFDLIVVGSGFYGLTVAERAASQLGKRVLVLERRDHIGGNA
FT                   YSEAEPETGIEVHRYGAHLFHTSNKRVWDYVNQFTEFTGYQHRVFAMHDGTAYQFPMGL
FT                   GLITQFVGKYLSPDEARAWVAEQAAEIDAKDATNLEEKAISLIGRPLYEAFVRDYTAKQ
FT                   WQTDPKELPAAVISRLPVRYNFDNRYFNDTYEGLPVDGYTAWLQKMADHENIEVRLGTD
FT                   FFDVRADIPEGTPVVYTGPVDRYFDYSEGWLGWRTLDFEMEVLNTGDFQGTPVMNYNDA
FT                   DVPYTRIHEFRHFHPEREYPADKTVIVREFSRSAEKEDEPYYPINTAEDRAKLEKYREL
FT                   AKKEASEHNVLFGGRLGTYKYLDMHMAIGAALTAFDNKIAPHLTEGKALDGSLD"
     MSFAGFDLIV VGSGFYGLTV AERAASQLGK RVLVLERRDH IGGNAYSEAE PETGIEVHRY        60
     GAHLFHTSNK RVWDYVNQFT EFTGYQHRVF AMHDGTAYQF PMGLGLITQF VGKYLSPDEA       120
     RAWVAEQAAE IDAKDATNLE EKAISLIGRP LYEAFVRDYT AKQWQTDPKE LPAAVISRLP       180
     VRYNFDNRYF NDTYEGLPVD GYTAWLQKMA DHENIEVRLG TDFFDVRADI PEGTPVVYTG       240
     PVDRYFDYSE GWLGWRTLDF EMEVLNTGDF QGTPVMNYND ADVPYTRIHE FRHFHPEREY       300
     PADKTVIVRE FSRSAEKEDE PYYPINTAED RAKLEKYREL AKKEASEHNV LFGGRLGTYK       360
     YLDMHMAIGA ALTAFDNKIA PHLTEGKALD GSLD                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page