(data stored in ACNUC7421 zone)

EMBL: CP001630.PE126

CP001630.PE126       Location/Qualifiers
FT   CDS             complement(139453..140256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34100"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34100.1"
FT                   /translation="MRKAGITALAIAATAAALGGAPAASAAEGTGTVTGVIWQDLNANG
FT                   ERDAGEPGLKGAYVGIDGLSSTYTRTEADGSYTITAPAGSGYRVHLADGLLSGYVWGPE
FT                   VRGHSVFGHCTGKSLPIDLGAGEVVANANGGVVAPSFDFQPTGLTLSPAKDVYAVGDVV
FT                   EVLGGIGHDGAGCYGTSAVLSLPDGVTKLDRLGDYLPFYATDKPNEVTGQPDGRRAGRH
FT                   PFTLGARVVVDRPLDAAEFTLSTMWNDSFDPDHTNNSATTTLSAR"
     MRKAGITALA IAATAAALGG APAASAAEGT GTVTGVIWQD LNANGERDAG EPGLKGAYVG        60
     IDGLSSTYTR TEADGSYTIT APAGSGYRVH LADGLLSGYV WGPEVRGHSV FGHCTGKSLP       120
     IDLGAGEVVA NANGGVVAPS FDFQPTGLTL SPAKDVYAVG DVVEVLGGIG HDGAGCYGTS       180
     AVLSLPDGVT KLDRLGDYLP FYATDKPNEV TGQPDGRRAG RHPFTLGARV VVDRPLDAAE       240
     FTLSTMWNDS FDPDHTNNSA TTTLSAR                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page