(data stored in ACNUC7421 zone)

EMBL: CP001630.PE127

CP001630.PE127       Location/Qualifiers
FT   CDS             complement(140289..141086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_5514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34101"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34101.1"
FT                   /translation="MRKAGITALAIAATAAALGGAPAASAAEATGTVAGFVWQDLNANG
FT                   LRDAGEPGVKNAYVGIKGLNSSYVATAADGSYSITAPAGSHVVHLGDQSGFGKVWGPQA
FT                   EGGSAFGHCTGETAPISVGAGETARVDGGLVPAVFDFQPTGLTLSPAKDVYAVGDVVEV
FT                   LGGITHDGAGCSGAHATLDLPAGVTKLDRLGDYLPFYATDKPNQVTGQVNERRAAGHAY
FT                   TLGARVVVDRPLDAAEFRISTMWNYSEDPDHTNNSATTTITAN"
     MRKAGITALA IAATAAALGG APAASAAEAT GTVAGFVWQD LNANGLRDAG EPGVKNAYVG        60
     IKGLNSSYVA TAADGSYSIT APAGSHVVHL GDQSGFGKVW GPQAEGGSAF GHCTGETAPI       120
     SVGAGETARV DGGLVPAVFD FQPTGLTLSP AKDVYAVGDV VEVLGGITHD GAGCSGAHAT       180
     LDLPAGVTKL DRLGDYLPFY ATDKPNQVTG QVNERRAAGH AYTLGARVVV DRPLDAAEFR       240
     ISTMWNYSED PDHTNNSATT TITAN                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page