(data stored in ACNUC7421 zone)

EMBL: CP001630.PE128

CP001630.PE128       Location/Qualifiers
FT   CDS             complement(141148..141948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_1080 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34102"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34102.1"
FT                   /translation="MTVKKTARIAALALTAAAATLAAAPAALAGPAGGEATVTGVIWND
FT                   LNANGLRDAGEPGIKGAYVGVLGGSYTTTAEDGGYSLTAPSGLAVQVHAADRSGWGAVW
FT                   GPEAEGGSVFGHCTGESGAVVLEPGQVLSGYDGGFVTSKVDYSPAPITLSPAKDVYAVG
FT                   DVVEVLGGIGHEGPGCAQLFAEVQLPEGVTKLDRLGDLRPYMSDGPRTVTGWTADRQAP
FT                   GTPGAIGARFVVDSPLSAATITVKSAWFDSNPANDSASVQLNAS"
     MTVKKTARIA ALALTAAAAT LAAAPAALAG PAGGEATVTG VIWNDLNANG LRDAGEPGIK        60
     GAYVGVLGGS YTTTAEDGGY SLTAPSGLAV QVHAADRSGW GAVWGPEAEG GSVFGHCTGE       120
     SGAVVLEPGQ VLSGYDGGFV TSKVDYSPAP ITLSPAKDVY AVGDVVEVLG GIGHEGPGCA       180
     QLFAEVQLPE GVTKLDRLGD LRPYMSDGPR TVTGWTADRQ APGTPGAIGA RFVVDSPLSA       240
     ATITVKSAWF DSNPANDSAS VQLNAS                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page