(data stored in ACNUC7421 zone)

EMBL: CP001630.PE129

CP001630.PE129       Location/Qualifiers
FT   CDS             complement(142456..143352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0132"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   apl:APL_1469 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34103"
FT                   /db_xref="GOA:C6WDV8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34103.1"
FT                   /translation="MSALPKGSVVGVVVTRHRRELLADSLKVLASQTRQLDHLVVVDNG
FT                   PDQPVDDLVAECPIPTTYLVSHRNLGGAGGFALGMLHALSLGADWVWLADDDGRPADET
FT                   VLEVLLQEAGRRNLAAISPVVTNIERPEKLAFPMRRGLTWKRDTGALGSDFLPGIASLF
FT                   NGALFRASTLDVVGVPDYRLFFRGDEVEIHRRLVRSGLPFGTSLKVAYLHPDGSDEFKP
FT                   MLGGRFHAQDPENQIKRYYTYRNRGYLLSQPGMRKLGLLELARFGLYFLGVRKDPKAFV
FT                   EWLKLVRLGQRERFFRK"
     MSALPKGSVV GVVVTRHRRE LLADSLKVLA SQTRQLDHLV VVDNGPDQPV DDLVAECPIP        60
     TTYLVSHRNL GGAGGFALGM LHALSLGADW VWLADDDGRP ADETVLEVLL QEAGRRNLAA       120
     ISPVVTNIER PEKLAFPMRR GLTWKRDTGA LGSDFLPGIA SLFNGALFRA STLDVVGVPD       180
     YRLFFRGDEV EIHRRLVRSG LPFGTSLKVA YLHPDGSDEF KPMLGGRFHA QDPENQIKRY       240
     YTYRNRGYLL SQPGMRKLGL LELARFGLYF LGVRKDPKAF VEWLKLVRLG QRERFFRK         298
//

If you have problems or comments...

PBIL Back to PBIL home page