(data stored in ACNUC7421 zone)

EMBL: CP001630.PE13

CP001630.PE13        Location/Qualifiers
FT   CDS             14769..15317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0013"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: bba:Bd0177 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33987"
FT                   /db_xref="GOA:C6WCG6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG6"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU33987.1"
FT                   /translation="MADSNESLVGRKVTATLHTSQGVIKINLFPDHAPKTVANFVGLAE
FT                   GTKAYTEANAKGEASGPFYDGAIFHRVIAGFMLQGGDPTGTGRGGPGYKFADEFHPELK
FT                   FDRPYLLAMANAGPNTNGSQFFITVAPTSWLNFKHTIFGEVADQDSRNVVDAIENGPTG
FT                   AADRPVKDVVIEKVAIEKV"
     MADSNESLVG RKVTATLHTS QGVIKINLFP DHAPKTVANF VGLAEGTKAY TEANAKGEAS        60
     GPFYDGAIFH RVIAGFMLQG GDPTGTGRGG PGYKFADEFH PELKFDRPYL LAMANAGPNT       120
     NGSQFFITVA PTSWLNFKHT IFGEVADQDS RNVVDAIENG PTGAADRPVK DVVIEKVAIE       180
     KV                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page