(data stored in ACNUC7421 zone)

EMBL: CP001630.PE130

CP001630.PE130       Location/Qualifiers
FT   CDS             complement(143356..144171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0133"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cbc:CbuK_1550 polysaccharide export ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34104"
FT                   /db_xref="GOA:C6WDV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34104.1"
FT                   /translation="MVSIDVWNASVDFPIFDAKSRSLKKLALGKVGGKIGSEGRVPIIE
FT                   ALHDINISLKHGDRVGLVGHNGAGKSTLLRLLAGIYEPTRGSSRIVGKVAPVFDLGVGM
FT                   DPEISGYENIMIRGLFLGMSRKEMEKRVDDIASFTELGDYLSMPLRTYSTGMRVRLALG
FT                   VVTSINPEILLLDEGIGAVDAAFLEKARDRLNDLVDRAGLLVFASHADEWLAELCTKAI
FT                   WMDEGRVKQQGDLREVLTAYKGRDPFANMSEETLKRLGQSKVTTANGGE"
     MVSIDVWNAS VDFPIFDAKS RSLKKLALGK VGGKIGSEGR VPIIEALHDI NISLKHGDRV        60
     GLVGHNGAGK STLLRLLAGI YEPTRGSSRI VGKVAPVFDL GVGMDPEISG YENIMIRGLF       120
     LGMSRKEMEK RVDDIASFTE LGDYLSMPLR TYSTGMRVRL ALGVVTSINP EILLLDEGIG       180
     AVDAAFLEKA RDRLNDLVDR AGLLVFASHA DEWLAELCTK AIWMDEGRVK QQGDLREVLT       240
     AYKGRDPFAN MSEETLKRLG QSKVTTANGG E                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page