(data stored in ACNUC7421 zone)

EMBL: CP001630.PE131

CP001630.PE131       Location/Qualifiers
FT   CDS             complement(144188..145099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0134"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tbd:Tbd_1878 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34105"
FT                   /db_xref="GOA:C6WDW0"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU34105.1"
FT                   /translation="MQPTSTVADPQAPLAPDSRTFARAFADVRDAWRNRALWGHLGWQD
FT                   IKQRYRRSVIGPLWITISMGTTAVAMGLLYSQLFGQDISTFLPYMTAGFLIWNFMVGCI
FT                   TEGTDVFIANEGLIKHLPAPITVHVLRLVWRQMLFFVHNLVVYVIVAGIFFGTLSEPYH
FT                   MQGDPNLHPGISWTILLAIPGFFLLAVNAVWVALLFGIISTRFRDIPPVIHSFINLVFF
FT                   MTPIVWHTGILSKLGEGSGDWRVLIAELNPLYHFLEIVRAPLLGHAQDWHHWVVVGAFT
FT                   VVGWALALVALRNYRARVSYWV"
     MQPTSTVADP QAPLAPDSRT FARAFADVRD AWRNRALWGH LGWQDIKQRY RRSVIGPLWI        60
     TISMGTTAVA MGLLYSQLFG QDISTFLPYM TAGFLIWNFM VGCITEGTDV FIANEGLIKH       120
     LPAPITVHVL RLVWRQMLFF VHNLVVYVIV AGIFFGTLSE PYHMQGDPNL HPGISWTILL       180
     AIPGFFLLAV NAVWVALLFG IISTRFRDIP PVIHSFINLV FFMTPIVWHT GILSKLGEGS       240
     GDWRVLIAEL NPLYHFLEIV RAPLLGHAQD WHHWVVVGAF TVVGWALALV ALRNYRARVS       300
     YWV                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page