(data stored in ACNUC7421 zone)

EMBL: CP001630.PE132

CP001630.PE132       Location/Qualifiers
FT   CDS             complement(145369..145917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34106"
FT                   /db_xref="GOA:C6WDW1"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34106.1"
FT                   /translation="MNEPREQAEADQHVIVVGPDGAPVGAARLGGGEDGVPQDVTELVE
FT                   QPAKVMRIGTMIKQLLEEVRAAPLDEASRARLKEIHKRSIHELEDGLAPELRDELERLS
FT                   LPFTEEGTPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRGRALPPGS
FT                   GSSATSTEGGHFKGTGQYL"
     MNEPREQAEA DQHVIVVGPD GAPVGAARLG GGEDGVPQDV TELVEQPAKV MRIGTMIKQL        60
     LEEVRAAPLD EASRARLKEI HKRSIHELED GLAPELRDEL ERLSLPFTEE GTPSDAELRI       120
     AQAQLVGWLE GLFHGIQTAL FAQQMAARAQ LEQMRGRALP PGSGSSATST EGGHFKGTGQ       180
     YL                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page