(data stored in ACNUC7421 zone)

EMBL: CP001630.PE133

CP001630.PE133       Location/Qualifiers
FT   CDS             146032..147231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0136"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="TIGRFAM: cysteine desulfurase family protein; PFAM:
FT                   aminotransferase class V; KEGG: mlo:mlr0102
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34107"
FT                   /db_xref="GOA:C6WDW2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW2"
FT                   /inference="protein motif:TFAM:TIGR01976"
FT                   /protein_id="ACU34107.1"
FT                   /translation="MAFDVARVRGLFPALGDGWVHLDAPAGMQVPEQVATAVSTALRAP
FT                   VSGPGGIFPASQRAEAIVDAARRAVADLVGADPAGVVLGPSSAVLLQRLSDALSEGWFL
FT                   CDEVVVSRLDHPGNIAPWQRAAQRTGSVVRFAEVDIETCELPAWQYDELITDKCKLVAV
FT                   TAASGAVGTRPDLPRIGAVAREHGALVVVDASAAAPFVPLDITSMRADVVAVSANTWGG
FT                   PPVGALVFRDPSLLDLLPSVAVEAGARGPERLELGPHAYPLLAGLVASVEYLAGLDDAA
FT                   IGPRREKLLTSLGSVKAYQAGLLANLIHELRSLRHVTVIGDAMRRVPALAFTVAGVKSA
FT                   EAVEHLSERGVCAFADPGQHGVFSVLGVGEVGGAVRVGLAHYTNAAEVDDLVRAVAELG
FT                   "
     MAFDVARVRG LFPALGDGWV HLDAPAGMQV PEQVATAVST ALRAPVSGPG GIFPASQRAE        60
     AIVDAARRAV ADLVGADPAG VVLGPSSAVL LQRLSDALSE GWFLCDEVVV SRLDHPGNIA       120
     PWQRAAQRTG SVVRFAEVDI ETCELPAWQY DELITDKCKL VAVTAASGAV GTRPDLPRIG       180
     AVAREHGALV VVDASAAAPF VPLDITSMRA DVVAVSANTW GGPPVGALVF RDPSLLDLLP       240
     SVAVEAGARG PERLELGPHA YPLLAGLVAS VEYLAGLDDA AIGPRREKLL TSLGSVKAYQ       300
     AGLLANLIHE LRSLRHVTVI GDAMRRVPAL AFTVAGVKSA EAVEHLSERG VCAFADPGQH       360
     GVFSVLGVGE VGGAVRVGLA HYTNAAEVDD LVRAVAELG                              399
//

If you have problems or comments...

PBIL Back to PBIL home page