(data stored in ACNUC7421 zone)

EMBL: CP001630.PE134

CP001630.PE134       Location/Qualifiers
FT   CDS             147357..148010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34108"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW3"
FT                   /inference="similar to AA sequence:KEGG:Meso_0486"
FT                   /protein_id="ACU34108.1"
FT                   /translation="MGTGLDEALARELADLSALHRLAPLMSEYLPSTAHELSPSALVAL
FT                   LDEVLVGSRTVLVECGCGSSSVVLARLLAKRGFGHLLSLEHDERTAAFVASQLRREGLG
FT                   HVARVVHAPLAAHPAAGPGGQWYAPSAVRDEVSSFVDSHGLVDLLMVDGPLLGDSRYPA
FT                   LPVFRDVLAPGAAVLVDDAHRPGERAVLERWSREYALRFRPTGGTSLAAATALA"
     MGTGLDEALA RELADLSALH RLAPLMSEYL PSTAHELSPS ALVALLDEVL VGSRTVLVEC        60
     GCGSSSVVLA RLLAKRGFGH LLSLEHDERT AAFVASQLRR EGLGHVARVV HAPLAAHPAA       120
     GPGGQWYAPS AVRDEVSSFV DSHGLVDLLM VDGPLLGDSR YPALPVFRDV LAPGAAVLVD       180
     DAHRPGERAV LERWSREYAL RFRPTGGTSL AAATALA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page