(data stored in ACNUC7421 zone)

EMBL: CP001630.PE135

CP001630.PE135       Location/Qualifiers
FT   CDS             complement(148245..149723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34109"
FT                   /db_xref="InterPro:IPR029121"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW4"
FT                   /inference="similar to AA sequence:KEGG:sce7164"
FT                   /protein_id="ACU34109.1"
FT                   /translation="MHSDRARPDQDRRSAARVPAPRARSPRAGEEAASGEPPSALSTGE
FT                   LIGIQQRAGNGAASAIVQRMVEDQGDDDRPGPSAEAKGKKKATPESDLANALAPGGGEP
FT                   GSPARVAAVRAALHTRQRNGPMFTGPQLAAIEQADPTWLDAVGVGTREAADRYLAEGSY
FT                   RQWNSLDPGRRVLLATIAFRQRHAATAPDAQLNSPAYTLGRSLFFRERGVPPEDIARLE
FT                   QQQGDQITSAYVETLLREDAPPEVTGAEAARQKQVVTRAREVLIRVFVLLQAGLKVYNG
FT                   EGAHIDYTEGDVTRALAHGGRVNVRVPRLRLGENPFFMNEFLRLKALEERRPFSSHHMK
FT                   LGTAFENKFVEQGEGMASFKNALALIAGFGLWHRMHGLNLAAGGWGNRDFNNDVITPDG
FT                   GHGHLFLAFQPPNLWKNGSVQIGMETTAPRLPVVGKKVPNPVGYEHTARSTEKTANPES
FT                   SFHGHKSDKIGKGGLEDSGRLVDLGGWGPTGSGP"
     MHSDRARPDQ DRRSAARVPA PRARSPRAGE EAASGEPPSA LSTGELIGIQ QRAGNGAASA        60
     IVQRMVEDQG DDDRPGPSAE AKGKKKATPE SDLANALAPG GGEPGSPARV AAVRAALHTR       120
     QRNGPMFTGP QLAAIEQADP TWLDAVGVGT REAADRYLAE GSYRQWNSLD PGRRVLLATI       180
     AFRQRHAATA PDAQLNSPAY TLGRSLFFRE RGVPPEDIAR LEQQQGDQIT SAYVETLLRE       240
     DAPPEVTGAE AARQKQVVTR AREVLIRVFV LLQAGLKVYN GEGAHIDYTE GDVTRALAHG       300
     GRVNVRVPRL RLGENPFFMN EFLRLKALEE RRPFSSHHMK LGTAFENKFV EQGEGMASFK       360
     NALALIAGFG LWHRMHGLNL AAGGWGNRDF NNDVITPDGG HGHLFLAFQP PNLWKNGSVQ       420
     IGMETTAPRL PVVGKKVPNP VGYEHTARST EKTANPESSF HGHKSDKIGK GGLEDSGRLV       480
     DLGGWGPTGS GP                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page