(data stored in ACNUC7421 zone)

EMBL: CP001630.PE136

CP001630.PE136       Location/Qualifiers
FT   CDS             complement(149847..150821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0139"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34110"
FT                   /db_xref="GOA:C6WDW5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW5"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACU34110.1"
FT                   /translation="MRAITLSEFGGPEVLQWSEVRDPAPGPGEVLLDVAATAVNRADLL
FT                   QRKGHYPPPRGASEVLGLECSGVVAALGPGVEGWSVGDEVCALLAGGGYAERVVVPAAQ
FT                   LLPVPVGVDLVTAAALPEVACTVWSNVVVLAGLRAGETLLVHGGAGGIGTHAIQVGKAL
FT                   GARVAVTAGSAERLARCAELGADVLVDYREQDFVEVVGAADVVLDNMGASYLGRNVDVL
FT                   APDGRLVVIGMQGGVKGELDLGKMLGKRASLIATGLRHRPVEGRTGKGAVVAAVREGLW
FT                   PLVADGRVRPVVHEVLPLERAADAHRALEGGGAVFGKLVLATG"
     MRAITLSEFG GPEVLQWSEV RDPAPGPGEV LLDVAATAVN RADLLQRKGH YPPPRGASEV        60
     LGLECSGVVA ALGPGVEGWS VGDEVCALLA GGGYAERVVV PAAQLLPVPV GVDLVTAAAL       120
     PEVACTVWSN VVVLAGLRAG ETLLVHGGAG GIGTHAIQVG KALGARVAVT AGSAERLARC       180
     AELGADVLVD YREQDFVEVV GAADVVLDNM GASYLGRNVD VLAPDGRLVV IGMQGGVKGE       240
     LDLGKMLGKR ASLIATGLRH RPVEGRTGKG AVVAAVREGL WPLVADGRVR PVVHEVLPLE       300
     RAADAHRALE GGGAVFGKLV LATG                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page