(data stored in ACNUC7421 zone)

EMBL: CP001630.PE137

CP001630.PE137       Location/Qualifiers
FT   CDS             150866..151498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0140"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   atc:AGR_C_5049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34111"
FT                   /db_xref="GOA:C6WDW6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34111.1"
FT                   /translation="MNPWPFHDLVITTPRLELRPDDDAGLLELAAEAQRGVHPPEYMPF
FT                   AFPWTDASADRLATSTLQHHWRMRAALTLDDWSLNFLVRLDGRVIGTQSVEAKDFAATR
FT                   EVMTGSWLGLRHQGSGLGTEMRAAVLAYAFDHLGAVQARSAAWEDNAASLAVSRKLGYR
FT                   PDGTKVAVRRGEAVTEIRLLVTREQFTRPTWNPTVEGHAACAELLTA"
     MNPWPFHDLV ITTPRLELRP DDDAGLLELA AEAQRGVHPP EYMPFAFPWT DASADRLATS        60
     TLQHHWRMRA ALTLDDWSLN FLVRLDGRVI GTQSVEAKDF AATREVMTGS WLGLRHQGSG       120
     LGTEMRAAVL AYAFDHLGAV QARSAAWEDN AASLAVSRKL GYRPDGTKVA VRRGEAVTEI       180
     RLLVTREQFT RPTWNPTVEG HAACAELLTA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page