(data stored in ACNUC7421 zone)

EMBL: CP001630.PE138

CP001630.PE138       Location/Qualifiers
FT   CDS             151575..153095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0141"
FT                   /product="Aminopeptidase Y"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; KEGG: pag:PLES_21241 putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34112"
FT                   /db_xref="GOA:C6WDW7"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW7"
FT                   /inference="protein motif:PRIAM:3.4.11.15"
FT                   /protein_id="ACU34112.1"
FT                   /translation="MSAKNGVRRAVAIAASASLALVAVPTATAAPAGPDGPALAKKLTK
FT                   EVGVDGVNRHLIALQRIADRNDGNRAVGTPGYDASVDYVVGKLRGAGYEVTTPQFTYPV
FT                   QVYDAATAAVGGDEYEALALEESPQTPVGGLTGPLRAVPEDATPGCEADDFAGQDFTGA
FT                   IALIRRGACTFDVKHRNAAAAGAVAVLVANNADGPLSGVTLGSPGVVPTGGVSKADGTA
FT                   LFGRAGQQVTVDLRFHEENRVARNVIAQTRTGRSDNVVMAGAHLDSVEEGPGINDNGTG
FT                   SAGLLETALKLGGSPKVNNAVRFAWWGAEELGLVGSTEYVRALDFEQQLDIALYLNFDM
FT                   IGSPNAAYFVYDGDDSDGVGAGPGPHGSAQVEQAFTDYLAAAKGVEVEGTDFDGRSDYG
FT                   EFIARGIPAGGLFTGAEGKKTDDQAAKWGGEAGAAFDPNYHGPGDTLANLDRTALDRNA
FT                   DALAWVTASYAISTEDVNGVPPRATRSTSRAAAQARAAVVHPSHADVA"
     MSAKNGVRRA VAIAASASLA LVAVPTATAA PAGPDGPALA KKLTKEVGVD GVNRHLIALQ        60
     RIADRNDGNR AVGTPGYDAS VDYVVGKLRG AGYEVTTPQF TYPVQVYDAA TAAVGGDEYE       120
     ALALEESPQT PVGGLTGPLR AVPEDATPGC EADDFAGQDF TGAIALIRRG ACTFDVKHRN       180
     AAAAGAVAVL VANNADGPLS GVTLGSPGVV PTGGVSKADG TALFGRAGQQ VTVDLRFHEE       240
     NRVARNVIAQ TRTGRSDNVV MAGAHLDSVE EGPGINDNGT GSAGLLETAL KLGGSPKVNN       300
     AVRFAWWGAE ELGLVGSTEY VRALDFEQQL DIALYLNFDM IGSPNAAYFV YDGDDSDGVG       360
     AGPGPHGSAQ VEQAFTDYLA AAKGVEVEGT DFDGRSDYGE FIARGIPAGG LFTGAEGKKT       420
     DDQAAKWGGE AGAAFDPNYH GPGDTLANLD RTALDRNADA LAWVTASYAI STEDVNGVPP       480
     RATRSTSRAA AQARAAVVHP SHADVA                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page