(data stored in ACNUC7421 zone)

EMBL: CP001630.PE139

CP001630.PE139       Location/Qualifiers
FT   CDS             complement(153173..154078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0142"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: rfr:Rfer_2725 protein of
FT                   unknown function, zinc metallopeptidase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34113"
FT                   /db_xref="GOA:C6WDW8"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW8"
FT                   /inference="protein motif:PFAM:PF04228"
FT                   /protein_id="ACU34113.1"
FT                   /translation="MQFNEDAELDTSQVNDQRGVGGRVALGGGGLGIVGVIIYLVLNQI
FT                   GGGVPLPQGSGFGDVGQNQQVGSQSLGQKCRTGADANRSDDCRAVAFINSIQAFWNDQF
FT                   ARSGRSYKAAQTNFFSGGVRTNGCGSASSASGPFYCPADSQVYIDLTFFQELKTKFGAT
FT                   GGPFVEAYVLAHEYGHHVQNLLGTSSRVGGETGPKSGSVRLELQADCYAGAWANHATTT
FT                   PAASGKPLITGVTDQDIAAALDAAARIGDDFIQKELGGGRVDTTQFSHGSSEQRQKWYT
FT                   AGYRSGNPAQCGTFDTDDLG"
     MQFNEDAELD TSQVNDQRGV GGRVALGGGG LGIVGVIIYL VLNQIGGGVP LPQGSGFGDV        60
     GQNQQVGSQS LGQKCRTGAD ANRSDDCRAV AFINSIQAFW NDQFARSGRS YKAAQTNFFS       120
     GGVRTNGCGS ASSASGPFYC PADSQVYIDL TFFQELKTKF GATGGPFVEA YVLAHEYGHH       180
     VQNLLGTSSR VGGETGPKSG SVRLELQADC YAGAWANHAT TTPAASGKPL ITGVTDQDIA       240
     AALDAAARIG DDFIQKELGG GRVDTTQFSH GSSEQRQKWY TAGYRSGNPA QCGTFDTDDL       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page