(data stored in ACNUC7421 zone)

EMBL: CP001630.PE14

CP001630.PE14        Location/Qualifiers
FT   CDS             15317..16213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0014"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: bsu:BSU24870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33988"
FT                   /db_xref="GOA:C6WCG7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG7"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACU33988.1"
FT                   /translation="MAGTPVPPGGPIGAQPGQAACARHPDRATGLLCARCERPACPDCL
FT                   REAAVGFQCVDCVTEGARTTRQARTVEGATHASTGRRLLVVPVLIVVNLALFALTAYLG
FT                   GGVTDRDVFQSDVTQEGALVPYFVALGEWWRLVTSGFLHLGVTHIGLNMASLYILGRDL
FT                   EPVLGRARFLAVYLLSLLGGSASVYLFEEVVSLTAGASGAIYGLMGSLLVVLLRRRLNA
FT                   TPVLAIIAINVFLSFSLPNISILGHLGGIAVGAAVTAALVYAPRGPQRARWQAGSVVAF
FT                   AVALVVLTVVRTAVLVG"
     MAGTPVPPGG PIGAQPGQAA CARHPDRATG LLCARCERPA CPDCLREAAV GFQCVDCVTE        60
     GARTTRQART VEGATHASTG RRLLVVPVLI VVNLALFALT AYLGGGVTDR DVFQSDVTQE       120
     GALVPYFVAL GEWWRLVTSG FLHLGVTHIG LNMASLYILG RDLEPVLGRA RFLAVYLLSL       180
     LGGSASVYLF EEVVSLTAGA SGAIYGLMGS LLVVLLRRRL NATPVLAIIA INVFLSFSLP       240
     NISILGHLGG IAVGAAVTAA LVYAPRGPQR ARWQAGSVVA FAVALVVLTV VRTAVLVG         298
//

If you have problems or comments...

PBIL Back to PBIL home page