(data stored in ACNUC7421 zone)

EMBL: CP001630.PE140

CP001630.PE140       Location/Qualifiers
FT   CDS             complement(154537..156264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0143"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: scl:sce7039 putative
FT                   5'-nucleotidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34114"
FT                   /db_xref="GOA:C6WDW9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW9"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACU34114.1"
FT                   /translation="MTWFRRSAALAATAVAGAAVLLAQSPATPAQADGRASGKTVDVRL
FT                   IGINDLHGNIEPPTGSSGRVTLSDGTTVNAGGAAFNATHIKKLQSEVRNSVIVGQGDLI
FT                   GASPVVSALFHDEPTVEILNKVGMDATAAGNHEFDEGYRELLRMQHGGCHPVDGCQFSP
FT                   SYTGAKFKILGANVTLAKSGLPALPPFWVEFRDGVPIGFIGMPLKDVPILVDPNGIKDL
FT                   KFGDEIAAANKYADLLNWLGVKSIVLLVHQGDNTTGGGPDDCNTVSGGPGRLIAEKVSP
FT                   KIDAVFSGHSHQQYNCTVTDPAGNPRPFIEGLAFGRELSVVDLKIDKRTRDVVRSATKA
FT                   RNHVVTQDVTPDPKIQAVIDQAKTKAGPIANKQVGTIASDVLRAQNPAGESPLGNLIAD
FT                   SQLAATTGNGAVAALMNPGGVRADLTYAGSPAGEGDGVVTYGEAFTVQPFGNILQTVSL
FT                   TGAQLKAALEQQWQTVNGAQRQIVLQPSAGLTYSWSASAPQGAKISNLAINGTAVDPAA
FT                   SYRITINSFLQGGGDGFSAFTAGTSVTGGGIDLDAFAGYLATHPNVSAPALDRITTTP"
     MTWFRRSAAL AATAVAGAAV LLAQSPATPA QADGRASGKT VDVRLIGIND LHGNIEPPTG        60
     SSGRVTLSDG TTVNAGGAAF NATHIKKLQS EVRNSVIVGQ GDLIGASPVV SALFHDEPTV       120
     EILNKVGMDA TAAGNHEFDE GYRELLRMQH GGCHPVDGCQ FSPSYTGAKF KILGANVTLA       180
     KSGLPALPPF WVEFRDGVPI GFIGMPLKDV PILVDPNGIK DLKFGDEIAA ANKYADLLNW       240
     LGVKSIVLLV HQGDNTTGGG PDDCNTVSGG PGRLIAEKVS PKIDAVFSGH SHQQYNCTVT       300
     DPAGNPRPFI EGLAFGRELS VVDLKIDKRT RDVVRSATKA RNHVVTQDVT PDPKIQAVID       360
     QAKTKAGPIA NKQVGTIASD VLRAQNPAGE SPLGNLIADS QLAATTGNGA VAALMNPGGV       420
     RADLTYAGSP AGEGDGVVTY GEAFTVQPFG NILQTVSLTG AQLKAALEQQ WQTVNGAQRQ       480
     IVLQPSAGLT YSWSASAPQG AKISNLAING TAVDPAASYR ITINSFLQGG GDGFSAFTAG       540
     TSVTGGGIDL DAFAGYLATH PNVSAPALDR ITTTP                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page