(data stored in ACNUC7421 zone)

EMBL: CP001630.PE141

CP001630.PE141       Location/Qualifiers
FT   CDS             156424..156891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0144"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: acp:A2cp1_4259 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34115"
FT                   /db_xref="GOA:C6WDX0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34115.1"
FT                   /translation="MGAEPRWLDEGEMRAWRNYVVGAAMLSDRLHRELQTDHDLSLADY
FT                   EIMVRLSEQPGGRMRMSQLAEDVASSKSRVSHQVARMEKEGLVRRRECPEDGRGVFAEL
FT                   TADGARLLENSAPTHVRGVREHMVDLLSPEEQEVLAKVFNRVITHLRGSDG"
     MGAEPRWLDE GEMRAWRNYV VGAAMLSDRL HRELQTDHDL SLADYEIMVR LSEQPGGRMR        60
     MSQLAEDVAS SKSRVSHQVA RMEKEGLVRR RECPEDGRGV FAELTADGAR LLENSAPTHV       120
     RGVREHMVDL LSPEEQEVLA KVFNRVITHL RGSDG                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page