(data stored in ACNUC7421 zone)

EMBL: CP001630.PE142

CP001630.PE142       Location/Qualifiers
FT   CDS             157221..157970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0145"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sfu:Sfum_1521 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34116"
FT                   /db_xref="GOA:C6WDX1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX1"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACU34116.1"
FT                   /translation="MTVFEAVVVALAGMFAGAINTVVGSGTLVTFPVLLAIGYPPVVAN
FT                   VSNSLGLVPGSLSGAYGYREELKGQGERIRRLLPASVLGGIVGAVLLVVLPESAFSAIV
FT                   PVLIAVALVLVVAQPWINRKLAERRRPAHGGAALWIGVLLAGIYGGYFGAAQGVLVMGL
FT                   MGALVNDQLQRMNALKNVLTAFVNLVAGVLFIFIADVEWLVVLLLALGAVVGGQIGAKI
FT                   GRRLPPPVLRGVIVLVGLAAIAQLLLA"
     MTVFEAVVVA LAGMFAGAIN TVVGSGTLVT FPVLLAIGYP PVVANVSNSL GLVPGSLSGA        60
     YGYREELKGQ GERIRRLLPA SVLGGIVGAV LLVVLPESAF SAIVPVLIAV ALVLVVAQPW       120
     INRKLAERRR PAHGGAALWI GVLLAGIYGG YFGAAQGVLV MGLMGALVND QLQRMNALKN       180
     VLTAFVNLVA GVLFIFIADV EWLVVLLLAL GAVVGGQIGA KIGRRLPPPV LRGVIVLVGL       240
     AAIAQLLLA                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page