(data stored in ACNUC7421 zone)

EMBL: CP001630.PE143

CP001630.PE143       Location/Qualifiers
FT   CDS             complement(158047..159114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0146"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: scl:sce8915
FT                   histidinol-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34117"
FT                   /db_xref="GOA:C6WDX2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX2"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACU34117.1"
FT                   /translation="MSVRTRPDLSLLPPYVPGRSVPGAIKLASNEVSAGPLPSVVRAIA
FT                   DAATSVNRYPDSGSGALVERLSGKLGVPEEQIAVGCGSVTLCQQLVQATCGEGDEVLFP
FT                   WRSFEAYPIITQVVGATQRRVPLTPEHGLDLDAMAEAITPSTRLVFVCNPNNPTGTAVR
FT                   TEEVERFVERVPDDVLVVLDEAYKEFVDDPHVPDGVELAKAHWSRGRDNVAVLRTFSKA
FT                   YGLAGLRVGYAVGSPQVADALRKVYVPFGVNALAQVAAIASLDAEPELLERCRGLVVER
FT                   GRVRAELLAAGYEVPETQANFVWLPLGERTAAFNEHCLDRKVVVRAFAGDGARVTIGSP
FT                   EENEAFLVAARSFER"
     MSVRTRPDLS LLPPYVPGRS VPGAIKLASN EVSAGPLPSV VRAIADAATS VNRYPDSGSG        60
     ALVERLSGKL GVPEEQIAVG CGSVTLCQQL VQATCGEGDE VLFPWRSFEA YPIITQVVGA       120
     TQRRVPLTPE HGLDLDAMAE AITPSTRLVF VCNPNNPTGT AVRTEEVERF VERVPDDVLV       180
     VLDEAYKEFV DDPHVPDGVE LAKAHWSRGR DNVAVLRTFS KAYGLAGLRV GYAVGSPQVA       240
     DALRKVYVPF GVNALAQVAA IASLDAEPEL LERCRGLVVE RGRVRAELLA AGYEVPETQA       300
     NFVWLPLGER TAAFNEHCLD RKVVVRAFAG DGARVTIGSP EENEAFLVAA RSFER            355
//

If you have problems or comments...

PBIL Back to PBIL home page