(data stored in ACNUC7421 zone)

EMBL: CP001630.PE144

CP001630.PE144       Location/Qualifiers
FT   CDS             159236..159919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0147"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: cvi:CV_3204
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34118"
FT                   /db_xref="GOA:C6WDX3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX3"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ACU34118.1"
FT                   /translation="MKQTRIETLQLTDGRELRMTVAEPESAVRGGLVVLHEARGVTDAV
FT                   RGLVSGLAAEGWLAVAPHLYADDELDDDQAGTAVSGLDGESVLADTDVAFVWLGQRGVS
FT                   TDLMGVVGFDLGGSVAMAVAASRSVGAAVTVGGGGVLEPLAAGLPPLVDLAQELACPWL
FT                   GLYGASDDGVPAAEVAKLRDAAAGAPVATDVVRYEDSEHRFDTSPSNASDAWQRALNWF
FT                   DSHLR"
     MKQTRIETLQ LTDGRELRMT VAEPESAVRG GLVVLHEARG VTDAVRGLVS GLAAEGWLAV        60
     APHLYADDEL DDDQAGTAVS GLDGESVLAD TDVAFVWLGQ RGVSTDLMGV VGFDLGGSVA       120
     MAVAASRSVG AAVTVGGGGV LEPLAAGLPP LVDLAQELAC PWLGLYGASD DGVPAAEVAK       180
     LRDAAAGAPV ATDVVRYEDS EHRFDTSPSN ASDAWQRALN WFDSHLR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page