(data stored in ACNUC7421 zone)

EMBL: CP001630.PE145

CP001630.PE145       Location/Qualifiers
FT   CDS             complement(159963..160340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK21229 gene product from transcript GK21229-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34119"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34119.1"
FT                   /translation="MPWMRVVVAGATSAATSSADSTLVAAAPGASVPSSSSARAGVPGG
FT                   PPSACAAATSPGRTTWVDAVSAGGVGPVAGVGAPRKPAGAACVSRTVFPSLIHYPLALR
FT                   SRRNLAARYRRARPHALDAPP"
     MPWMRVVVAG ATSAATSSAD STLVAAAPGA SVPSSSSARA GVPGGPPSAC AAATSPGRTT        60
     WVDAVSAGGV GPVAGVGAPR KPAGAACVSR TVFPSLIHYP LALRSRRNLA ARYRRARPHA       120
     LDAPP                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page