(data stored in ACNUC7421 zone)

EMBL: CP001630.PE146

CP001630.PE146       Location/Qualifiers
FT   CDS             160367..161743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10507 gene product from transcript GH10507-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34120"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34120.1"
FT                   /translation="MIPDGATKHLGPAELAEAGRAVTQSTTQTISLKDLAHALPASSTT
FT                   HKITAADARPASTGQGPAATQVVPGAQPGGARTTPPGSTPPGGATAAGSAAPLPPAPQQ
FT                   QSAQPQAAQAAGAQGNQIVHGPVSPASTPAAPAPAAPAPAAAQNAAHQTPDAPPVLPTA
FT                   AAPSGMSAGTTAAAGATGPAAAPGATGTAADPTTATAAAPISEPISGTLADPTFATAAE
FT                   PAVAPADLDPADLVAGVPLGATTEPAATTGAAPIPAAPLPAAPPQTADPATTAAPSPAA
FT                   STPAPTTPATDPATADPVTAGATTAGATTAGAAAAAGDPAEGDASFTGAAKADLEKAGA
FT                   ALDAVDKGQVKLAMDNQSVDELLKLITEARDMVSSVHVTALTSLDVELRFGDNWVGRSI
FT                   SKRLHDLAVGDESSAVNVIGDFLRILLEVEETIRKAARNIRNADDDARDNFNKSGWGHH
FT                   "
     MIPDGATKHL GPAELAEAGR AVTQSTTQTI SLKDLAHALP ASSTTHKITA ADARPASTGQ        60
     GPAATQVVPG AQPGGARTTP PGSTPPGGAT AAGSAAPLPP APQQQSAQPQ AAQAAGAQGN       120
     QIVHGPVSPA STPAAPAPAA PAPAAAQNAA HQTPDAPPVL PTAAAPSGMS AGTTAAAGAT       180
     GPAAAPGATG TAADPTTATA AAPISEPISG TLADPTFATA AEPAVAPADL DPADLVAGVP       240
     LGATTEPAAT TGAAPIPAAP LPAAPPQTAD PATTAAPSPA ASTPAPTTPA TDPATADPVT       300
     AGATTAGATT AGAAAAAGDP AEGDASFTGA AKADLEKAGA ALDAVDKGQV KLAMDNQSVD       360
     ELLKLITEAR DMVSSVHVTA LTSLDVELRF GDNWVGRSIS KRLHDLAVGD ESSAVNVIGD       420
     FLRILLEVEE TIRKAARNIR NADDDARDNF NKSGWGHH                               458
//

If you have problems or comments...

PBIL Back to PBIL home page