(data stored in ACNUC7421 zone)

EMBL: CP001630.PE147

CP001630.PE147       Location/Qualifiers
FT   CDS             161743..163089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5390 glycin-rich signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34121"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34121.1"
FT                   /translation="MAGEQRDHRKNGDHANQGGGDQGGGDHGGYGRGNEPSELGQKVDW
FT                   MTYTHQQLYDMVHTGVDLDSATSAKAGWSGIGKSLGEVRDLLVKAINQSSQAWEGETAD
FT                   RAREGLESVMKWAQNTSDHAENVATCINEEIQHVVTAREQMPAPVPPTLPTAVVPGAVA
FT                   PGADQALVPSAIARAADVPATSTAESALTGSSTLGSALRRTATPESFAGLDTVAAPAAE
FT                   TTAVADATHRQAAEVMAMFQQNSYAVDLTVPSFSAPVNPVATPTPGAQVPLAPGGATAD
FT                   GPAGAGGSAVVNPAATTGQSSADRQRQQGGGSAGRMPAGAGRGAGGYGGGGVFARGRVP
FT                   SSGSGSSGGAGGGSLGATPIGAGGSSANVGSGHGASGSPGGVTSQFQASKAVAPQHGMI
FT                   GATPMAAPPPMAAGMGGGGNDSRNRPDYLEDDENVFGLDHKAAPPVIGL"
     MAGEQRDHRK NGDHANQGGG DQGGGDHGGY GRGNEPSELG QKVDWMTYTH QQLYDMVHTG        60
     VDLDSATSAK AGWSGIGKSL GEVRDLLVKA INQSSQAWEG ETADRAREGL ESVMKWAQNT       120
     SDHAENVATC INEEIQHVVT AREQMPAPVP PTLPTAVVPG AVAPGADQAL VPSAIARAAD       180
     VPATSTAESA LTGSSTLGSA LRRTATPESF AGLDTVAAPA AETTAVADAT HRQAAEVMAM       240
     FQQNSYAVDL TVPSFSAPVN PVATPTPGAQ VPLAPGGATA DGPAGAGGSA VVNPAATTGQ       300
     SSADRQRQQG GGSAGRMPAG AGRGAGGYGG GGVFARGRVP SSGSGSSGGA GGGSLGATPI       360
     GAGGSSANVG SGHGASGSPG GVTSQFQASK AVAPQHGMIG ATPMAAPPPM AAGMGGGGND       420
     SRNRPDYLED DENVFGLDHK AAPPVIGL                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page