(data stored in ACNUC7421 zone)

EMBL: CP001630.PE148

CP001630.PE148       Location/Qualifiers
FT   CDS             163086..163844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34122"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34122.1"
FT                   /translation="MTERVFRLSEQEFFLLWQSVHGPDVPVPLGARHYGHTQAERAGLV
FT                   ESASRALAGRGLGTVQRPDEQLHDILRGLGEYEVGLEVVFSRGGDQGRGLATAAWHGAF
FT                   AARAAGQVQLTSFHATALATKTIATLPAAPTGSGRSVSVRWTDYLAAGEAGRVDGAEGF
FT                   LEALRSVGVREPEANTLLRAVISRRGGGQVAVIARNRAGYLRPTGGAVSWLDTAEGRYL
FT                   VRRDGPWLVLAPANAQRLTSALEGVVAAGR"
     MTERVFRLSE QEFFLLWQSV HGPDVPVPLG ARHYGHTQAE RAGLVESASR ALAGRGLGTV        60
     QRPDEQLHDI LRGLGEYEVG LEVVFSRGGD QGRGLATAAW HGAFAARAAG QVQLTSFHAT       120
     ALATKTIATL PAAPTGSGRS VSVRWTDYLA AGEAGRVDGA EGFLEALRSV GVREPEANTL       180
     LRAVISRRGG GQVAVIARNR AGYLRPTGGA VSWLDTAEGR YLVRRDGPWL VLAPANAQRL       240
     TSALEGVVAA GR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page