(data stored in ACNUC7421 zone)

EMBL: CP001630.PE149

CP001630.PE149       Location/Qualifiers
FT   CDS             163955..165910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0152"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: sil:SPO1959
FT                   acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34123"
FT                   /db_xref="GOA:C6WDX8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX8"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACU34123.1"
FT                   /translation="MTDTQTGTAAGSPEPLWTPDPDRVAASRMAAFRDWLRAQRGLDLP
FT                   DYPSLWEWSTSDLEGFWGALAEFTSTRFHSPPERVLAVDAMPGAVWFPGATLNYAEHAL
FT                   RHEGVAVVLRREDGHRAELTYAELRARVAAARAALQALGVVAGDRVVGLVPNTPEALIA
FT                   FLAAASLGATWSSCSPDFGAPAVVDRFAQVTPKVLVAVPGYRYGGRDYDVRPVVARVRA
FT                   AVPSLVATVLIGGDEPGTLGWDALLAEHAGAEPAYDPVPFDHPLWVLYSSGTTGLPKGI
FT                   VHGHGGILLEHLKMLALHSDLGPGDRFTWFTTTGWMMWNYLVSGLLVGATAVLYDGSPG
FT                   HPDLSALWRVVEQERVTYFGTSAPYLQACLKAGLRPRDDHDLSALRVVGSTGAPLTPEG
FT                   FRWVADAVGDVQTASVSGGTDMCTAFVAAAPDLPVWVGELSCRALGAAVAAYDESGRPV
FT                   LDEVGELVVTRPMPSMPVFFWGDEDGARLREAYFETYPGVWRHGDWIRITPRGTAVIYG
FT                   RSDSTLNRGGVRMGTSEFYRVVEAVDGVADSLVVDTSDAANPDGELLCFVVLDAGAPLA
FT                   EVEAELRARLRALLSPRHVPDRFVEVAEVPRTLNGKKCEVPVKRILAGVDPERAVSRDA
FT                   LRNPDALLPFLNWISR"
     MTDTQTGTAA GSPEPLWTPD PDRVAASRMA AFRDWLRAQR GLDLPDYPSL WEWSTSDLEG        60
     FWGALAEFTS TRFHSPPERV LAVDAMPGAV WFPGATLNYA EHALRHEGVA VVLRREDGHR       120
     AELTYAELRA RVAAARAALQ ALGVVAGDRV VGLVPNTPEA LIAFLAAASL GATWSSCSPD       180
     FGAPAVVDRF AQVTPKVLVA VPGYRYGGRD YDVRPVVARV RAAVPSLVAT VLIGGDEPGT       240
     LGWDALLAEH AGAEPAYDPV PFDHPLWVLY SSGTTGLPKG IVHGHGGILL EHLKMLALHS       300
     DLGPGDRFTW FTTTGWMMWN YLVSGLLVGA TAVLYDGSPG HPDLSALWRV VEQERVTYFG       360
     TSAPYLQACL KAGLRPRDDH DLSALRVVGS TGAPLTPEGF RWVADAVGDV QTASVSGGTD       420
     MCTAFVAAAP DLPVWVGELS CRALGAAVAA YDESGRPVLD EVGELVVTRP MPSMPVFFWG       480
     DEDGARLREA YFETYPGVWR HGDWIRITPR GTAVIYGRSD STLNRGGVRM GTSEFYRVVE       540
     AVDGVADSLV VDTSDAANPD GELLCFVVLD AGAPLAEVEA ELRARLRALL SPRHVPDRFV       600
     EVAEVPRTLN GKKCEVPVKR ILAGVDPERA VSRDALRNPD ALLPFLNWIS R                651
//

If you have problems or comments...

PBIL Back to PBIL home page