(data stored in ACNUC7421 zone)

EMBL: CP001630.PE15

CP001630.PE15        Location/Qualifiers
FT   CDS             complement(16463..16885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33989"
FT                   /db_xref="GOA:C6WCG8"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33989.1"
FT                   /translation="MTSPPPTRSWAPNPAFVALAGALAVVVLVLLLMSPDAPSRVMLGL
FT                   AVALLGWMSLQGALVRPKLAVDETGLTVRGLRREHHMAWHEVKVRLQSTRRLGRVVRTL
FT                   ELDWERGEDERLVVLTQLDLGADPQDVAEVLHALRP"
     MTSPPPTRSW APNPAFVALA GALAVVVLVL LLMSPDAPSR VMLGLAVALL GWMSLQGALV        60
     RPKLAVDETG LTVRGLRREH HMAWHEVKVR LQSTRRLGRV VRTLELDWER GEDERLVVLT       120
     QLDLGADPQD VAEVLHALRP                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page