(data stored in ACNUC7421 zone)

EMBL: CP001630.PE150

CP001630.PE150       Location/Qualifiers
FT   CDS             complement(166576..168750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SAMD1; sterile alpha motif domain containing
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34124"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34124.1"
FT                   /translation="MSARTGELLGVDLEDCFVFQNGRLYPCEVWSRARIGVASRAHDAA
FT                   SGKPVEWSRRFRGEVEPLFRLGVVRLTGNGPEPVPDADLHAGLLAGDADERLVLVRRPD
FT                   VPYPDVPEVADTPVLPQALAEAEAAVLAGAPEGWRELVLGCRFFRAQAEFRAEVVLADG
FT                   STRSWTPPALAAQWLHRLRMTDHRTAWDWRFAPGAEVVREGRSEPPAPERPGNNRCELI
FT                   GPVGVFDGHAPRWYRPPVGEAELEAVLGYLRGAPVVLEGDGFVEDLVAEQTGGSRETEV
FT                   PLTHHTDGVLTWTSAVAYFLERHGVPPHPALVRRMRERDYAVGGVSEFGLRRGEVFAGD
FT                   DLAPGFREGRTAWASLQKALAPVRGFLEAHGLALEDTESTGWVVEVAPYDGYLVKPHGS
FT                   ATGEEFDSAEHAAMYLLGRLCAELGAPAAPAAAAVPPPAAPPLPAQHSQPLPVQHPRSQ
FT                   PLPVQQAQPVQQSLPLPVPPPGPQTPPPWQAQPLAPQDGQWRPGPHTVTTSNGPTHPKH
FT                   PGMPPVTPELLAAQRANRQPYVRCVDPAVNHPRFAGAVPDWAVYGAYLTNPATGELTGE
FT                   AVLNSEYRPSPRHLGLPEPRTELEAVLGLVTAGWLPSASAGDAALRAKLFVVMRGPDEL
FT                   PVIVSTTGARLMEVYTTRDRFLEGVQRTMDGRPQDHVGVFDEKLLVEVDAHSLLPSIHN
FT                   VVLVVNPRTGLTTRVAGSALIAAANRPVFR"
     MSARTGELLG VDLEDCFVFQ NGRLYPCEVW SRARIGVASR AHDAASGKPV EWSRRFRGEV        60
     EPLFRLGVVR LTGNGPEPVP DADLHAGLLA GDADERLVLV RRPDVPYPDV PEVADTPVLP       120
     QALAEAEAAV LAGAPEGWRE LVLGCRFFRA QAEFRAEVVL ADGSTRSWTP PALAAQWLHR       180
     LRMTDHRTAW DWRFAPGAEV VREGRSEPPA PERPGNNRCE LIGPVGVFDG HAPRWYRPPV       240
     GEAELEAVLG YLRGAPVVLE GDGFVEDLVA EQTGGSRETE VPLTHHTDGV LTWTSAVAYF       300
     LERHGVPPHP ALVRRMRERD YAVGGVSEFG LRRGEVFAGD DLAPGFREGR TAWASLQKAL       360
     APVRGFLEAH GLALEDTEST GWVVEVAPYD GYLVKPHGSA TGEEFDSAEH AAMYLLGRLC       420
     AELGAPAAPA AAAVPPPAAP PLPAQHSQPL PVQHPRSQPL PVQQAQPVQQ SLPLPVPPPG       480
     PQTPPPWQAQ PLAPQDGQWR PGPHTVTTSN GPTHPKHPGM PPVTPELLAA QRANRQPYVR       540
     CVDPAVNHPR FAGAVPDWAV YGAYLTNPAT GELTGEAVLN SEYRPSPRHL GLPEPRTELE       600
     AVLGLVTAGW LPSASAGDAA LRAKLFVVMR GPDELPVIVS TTGARLMEVY TTRDRFLEGV       660
     QRTMDGRPQD HVGVFDEKLL VEVDAHSLLP SIHNVVLVVN PRTGLTTRVA GSALIAAANR       720
     PVFR                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page