(data stored in ACNUC7421 zone)

EMBL: CP001630.PE151

CP001630.PE151       Location/Qualifiers
FT   CDS             complement(168872..169687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0154"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sml:Smlt3132 putative
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34125"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY0"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU34125.1"
FT                   /translation="MESLRAVSQWPVDSAAVAAVSSDGRVLGSHGDLERRYPLASVTKL
FT                   LTSYAVLVAVEEGAVEWDDPAGPEGSTVRHLIAHTSGLAFDSDKVQAAPGERRIYSNRG
FT                   FEVLADAVERSSGIAFGDYLAEAVLGPLGMGSTALEGSPAAGGVSTVADLVAFAAEVQS
FT                   PKLVSAGLVAEARTVAFPGLKGVLPGYGLQRENDWGLGFEIRSAKSPHWTGTTSSPGTH
FT                   GHFGQSGTFLWFDPALSAACVALTDRPFGEWAVAAWTPFTDSVVAELAR"
     MESLRAVSQW PVDSAAVAAV SSDGRVLGSH GDLERRYPLA SVTKLLTSYA VLVAVEEGAV        60
     EWDDPAGPEG STVRHLIAHT SGLAFDSDKV QAAPGERRIY SNRGFEVLAD AVERSSGIAF       120
     GDYLAEAVLG PLGMGSTALE GSPAAGGVST VADLVAFAAE VQSPKLVSAG LVAEARTVAF       180
     PGLKGVLPGY GLQRENDWGL GFEIRSAKSP HWTGTTSSPG THGHFGQSGT FLWFDPALSA       240
     ACVALTDRPF GEWAVAAWTP FTDSVVAELA R                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page