(data stored in ACNUC7421 zone)

EMBL: CP001630.PE152

CP001630.PE152       Location/Qualifiers
FT   CDS             169787..171295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0155"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: bur:Bcep18194_A5663 DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34126"
FT                   /db_xref="GOA:C6WDY1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY1"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACU34126.1"
FT                   /translation="MSRKSFPLVVVVVALAASTPALTASAAPSDCPAGTEGVPITWDEP
FT                   GLEWPANVVDAQVEDVGGTDLDVAVVLSDPASRNADDSNPLADFAAARPADLPGWAAIP
FT                   RTGTLSSYGPGYLTAGMNSLAVGDTVSYTVRFTRPVVVPDFTVGGIDHTGLGTVPARDP
FT                   WHSHQDEVVVTAVRAGTAVATSGTGTGLGGPYALGVDGTLPPGDPRATLVRGTAEPVTA
FT                   LRLDLSNGPDDEAAELADPRATVLPQPANSVADAVTVRVAGFTACLGTGAITSSVYADA
FT                   DRDGVRDPGEAGVAGAALELRDPQGSVLATTTADASGGYAFDRLPPMAWTVRLVSATPP
FT                   ATYTGPTSRTVALTPGEQATAAGDFAFQPPAPQPAATTTTAPPTTTAPTTTPPTTAPPT
FT                   TTAGPISSSPTTTAPTAPTTTAPAAGPITARPAPPSAQAQALASTGADVRALAPLGALL
FT                   VALGGLAVGASRRRARRAPGRAPVRPARTAPGGLAVSATRRRTR"
     MSRKSFPLVV VVVALAASTP ALTASAAPSD CPAGTEGVPI TWDEPGLEWP ANVVDAQVED        60
     VGGTDLDVAV VLSDPASRNA DDSNPLADFA AARPADLPGW AAIPRTGTLS SYGPGYLTAG       120
     MNSLAVGDTV SYTVRFTRPV VVPDFTVGGI DHTGLGTVPA RDPWHSHQDE VVVTAVRAGT       180
     AVATSGTGTG LGGPYALGVD GTLPPGDPRA TLVRGTAEPV TALRLDLSNG PDDEAAELAD       240
     PRATVLPQPA NSVADAVTVR VAGFTACLGT GAITSSVYAD ADRDGVRDPG EAGVAGAALE       300
     LRDPQGSVLA TTTADASGGY AFDRLPPMAW TVRLVSATPP ATYTGPTSRT VALTPGEQAT       360
     AAGDFAFQPP APQPAATTTT APPTTTAPTT TPPTTAPPTT TAGPISSSPT TTAPTAPTTT       420
     APAAGPITAR PAPPSAQAQA LASTGADVRA LAPLGALLVA LGGLAVGASR RRARRAPGRA       480
     PVRPARTAPG GLAVSATRRR TR                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page