(data stored in ACNUC7421 zone)

EMBL: CP001630.PE153

CP001630.PE153       Location/Qualifiers
FT   CDS             complement(171267..172106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0156"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: hha:Hhal_0769 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34127"
FT                   /db_xref="GOA:C6WDY2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACU34127.1"
FT                   /translation="MSPMRVLVTGARGYVGRAVAAELSGAGCEVVPLGCDVRSPEARDA
FT                   ARSVDAVVHLAALARVRESFERPLDYFDVNVAGTANLLRAEPARFVLASTAGVYGAPGV
FT                   PVLSEDVPRAPASPYAASKAAAEDLVRWAAPGGVVLRLFNVAGGGDRDDTRIVTRACAA
FT                   ASGRLGPLAVYGDGGAVRDFVHVRDAARAFLVALGLDGGVFNVGATAASVADVVAAVEQ
FT                   VAGRPPAVEHHPAHPGEVRELRSDSARLRAAGWAPERSGLVELVRDQWLSESAAGSR"
     MSPMRVLVTG ARGYVGRAVA AELSGAGCEV VPLGCDVRSP EARDAARSVD AVVHLAALAR        60
     VRESFERPLD YFDVNVAGTA NLLRAEPARF VLASTAGVYG APGVPVLSED VPRAPASPYA       120
     ASKAAAEDLV RWAAPGGVVL RLFNVAGGGD RDDTRIVTRA CAAASGRLGP LAVYGDGGAV       180
     RDFVHVRDAA RAFLVALGLD GGVFNVGATA ASVADVVAAV EQVAGRPPAV EHHPAHPGEV       240
     RELRSDSARL RAAGWAPERS GLVELVRDQW LSESAAGSR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page