(data stored in ACNUC7421 zone)

EMBL: CP001630.PE154

CP001630.PE154       Location/Qualifiers
FT   CDS             172215..172442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34128"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34128.1"
FT                   /translation="MPRTIEVALAEHAEREAERQHFLRTAAAVADSTPFPHPSRADDDT
FT                   LLALAIGVTRPRGRRAFLDRLDLVLREAAR"
     MPRTIEVALA EHAEREAERQ HFLRTAAAVA DSTPFPHPSR ADDDTLLALA IGVTRPRGRR        60
     AFLDRLDLVL REAAR                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page