(data stored in ACNUC7421 zone)

EMBL: CP001630.PE156

CP001630.PE156       Location/Qualifiers
FT   CDS             complement(174010..174810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34130"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34130.1"
FT                   /translation="MELPAAWWRPDPLRGVEDVPWRALSGGLGVDDLLRGAAEGEPGAC
FT                   DGLAARLLDEDTVSEATVRAVPFLVELGAGYKVPADTRDRVIFLLAAIALAGAGFTEGG
FT                   TRRTRRRWNRLGRELPRRQPDLMTQARQAVALGAPKVFDSLGLAEVACSMALAIAVPEV
FT                   APQHVVDVAHGIAFAGSFPEPLQESAVVALHLVHGWECDESWVYAIAQGDPELLRAYEE
FT                   GAFPPYQPSAVTLQLLGFRYAFLAAYGQEGVLGMDLLGGAPVTP"
     MELPAAWWRP DPLRGVEDVP WRALSGGLGV DDLLRGAAEG EPGACDGLAA RLLDEDTVSE        60
     ATVRAVPFLV ELGAGYKVPA DTRDRVIFLL AAIALAGAGF TEGGTRRTRR RWNRLGRELP       120
     RRQPDLMTQA RQAVALGAPK VFDSLGLAEV ACSMALAIAV PEVAPQHVVD VAHGIAFAGS       180
     FPEPLQESAV VALHLVHGWE CDESWVYAIA QGDPELLRAY EEGAFPPYQP SAVTLQLLGF       240
     RYAFLAAYGQ EGVLGMDLLG GAPVTP                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page