(data stored in ACNUC7421 zone)

EMBL: CP001630.PE157

CP001630.PE157       Location/Qualifiers
FT   CDS             174893..176107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0160"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   nmc:NMC1992 modification methylase (cytosine- specific DNA
FT                   methylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34131"
FT                   /db_xref="GOA:C6WDY6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY6"
FT                   /inference="protein motif:PRIAM:2.1.1.37"
FT                   /protein_id="ACU34131.1"
FT                   /translation="MRGPTYKVVDLFSGAGGMSLGFRTHRDFTVVGAADAQIGKPSSPL
FT                   GSLRCNNVYRDNIGIDPLQVDLGRIDPAVLREVWGLRRGELDVLVACPPCSGFTRITAA
FT                   NHLRDDPRNSLVGRVARFVAELRPKVLLMENARELVRGKQRHHLDGLAEQLIALGYEVD
FT                   ASSHMLSRFGLPQLRERAVVVAVDAGIPLRTLEDVWRGREVRPAAVTVRRAIGKLPPIP
FT                   AGYAHPDDAMHVSPSFRADRSLDRMRAIPVDGGSWADLVGAPDTELLLNPAQVKIIEAG
FT                   RWGSHPDVYGRMWWDEPARTIKRECAHVGNGRYAHPEQHRLCTVREMALLQGFPRKFRF
FT                   DVSVLGNAYRHLGDAVPPLISYQLASLVRWMLSGERPTARELCLPGTSLRPSDIRPALV
FT                   PSLVA"
     MRGPTYKVVD LFSGAGGMSL GFRTHRDFTV VGAADAQIGK PSSPLGSLRC NNVYRDNIGI        60
     DPLQVDLGRI DPAVLREVWG LRRGELDVLV ACPPCSGFTR ITAANHLRDD PRNSLVGRVA       120
     RFVAELRPKV LLMENARELV RGKQRHHLDG LAEQLIALGY EVDASSHMLS RFGLPQLRER       180
     AVVVAVDAGI PLRTLEDVWR GREVRPAAVT VRRAIGKLPP IPAGYAHPDD AMHVSPSFRA       240
     DRSLDRMRAI PVDGGSWADL VGAPDTELLL NPAQVKIIEA GRWGSHPDVY GRMWWDEPAR       300
     TIKRECAHVG NGRYAHPEQH RLCTVREMAL LQGFPRKFRF DVSVLGNAYR HLGDAVPPLI       360
     SYQLASLVRW MLSGERPTAR ELCLPGTSLR PSDIRPALVP SLVA                        404
//

If you have problems or comments...

PBIL Back to PBIL home page